Antibodies

Jump to Filters
View as table Download
Constitutive androstane receptor (NR1I3) Rabbit Polyclonal Antibody
AP20444PU-N

USD 370.00

2 Weeks

Constitutive androstane receptor (NR1I3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Constitutive androstane receptor (NR1I3) Rabbit Polyclonal Antibody
TA338166

USD 310.00

5 Days

Rabbit Polyclonal Anti-NR1I3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the N terminal of human NR1I3. Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA
Constitutive androstane receptor (NR1I3) Rabbit Polyclonal Antibody
TA338327

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR1I3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the middle region of human NR1I3. Synthetic peptide located within the following region: PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody [Clone ID: OTI2H10]
CF805288

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody [Clone ID: OTI10F9]
CF805306

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
CF805312

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA805146S

USD 159.00

2 Days

NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H10]
TA805288AM

USD 420.00

4 Weeks

NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody [Clone ID: OTI2H10]
TA805288S

USD 159.00

2 Days

NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10F9]
TA805306AM

USD 420.00

4 Weeks

NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody [Clone ID: OTI10F9]
TA805306S

USD 159.00

2 Days

NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]
TA805312AM

USD 420.00

4 Weeks

NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C6]
TA805312BM

USD 420.00

4 Weeks

NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
TA805312S

USD 159.00

In Stock

NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody [Clone ID: OTI10B1]
TA805313S

USD 159.00

2 Days

NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".