Constitutive androstane receptor (NR1I3) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Constitutive androstane receptor (NR1I3) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-NR1I3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the N terminal of human NR1I3. Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA |
Rabbit Polyclonal Anti-NR1I3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the middle region of human NR1I3. Synthetic peptide located within the following region: PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1), Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1), HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".