Antibodies

View as table Download

Rabbit anti-HMOX1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HMOX1

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)

UGT1A9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A9

Heme Oxygenase 1 (HMOX1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Canine, Hamster, Human, Monkey, Mouse, Rabbit, Rat
Immunogen Synthetic peptide derived from sequence near the amino terminus of Human HO-1 (Hsp32)

Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224)

Heme Oxygenase 1 (HMOX1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide corresponding to aa residues 12-25 + Cys-NH2 of the Human HO-1 protein

Goat Anti-HMOX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DQAGSTLARETLED, from the internal region of the protein sequence according to NP_002125.3.

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Rabbit Polyclonal Anti-COX15 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

Anti-HMOX1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-COX10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 300 amino acids of Human COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UGT2B4

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UGT1A6