Antibodies

View as table Download

Rabbit Polyclonal Anti-ATP6V0A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN

Rabbit Polyclonal Anti-Rubicon Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rubicon antibody was raised against a 16 amino acid peptide near the amino terminus of human Rubicon.

Rabbit Polyclonal Anti-CFTR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR.

Rabbit Polyclonal Anti-CFTR

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KEETEEEVQDTRL, corresponding to amino acid residues 1468-1480 of human CFTR . Cytoplasmic, C-terminal part.

Rabbit Polyclonal Anti-NKCC1 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RRQAMKEMSIDQAK, corresponding to amino acid residues 828-841 of human NKCC1. 6th extracellular loop.

Rabbit Polyclonal antibody to SEC61A1 (Sec61 alpha 1 subunit (S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 413 and 476 of SEC61A1

KDELR2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI

NKCC1 (SLC12A2) mouse monoclonal antibody, clone 5H7, Purified

Applications ELISA, IHC, WB
Reactivities Human

KDELR3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

ERp72 (PDIA4) (623-638) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen PDIA4 antibody was raised against a synthetic peptide based on the sequence of mouse ERp72 (residues 623-638) with a cysteine residue added and coupled to KLH.

NKCC1 (SLC12A2) (769-783) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Canine, Chicken, Equine, Human, Porcine
Immunogen Synthetic peptide from an internal region of human SLC12A2 / NKCC1 (NP_001037.1)

ATP6V0B (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 111-139 amino acids from the Central region of human ATP6V0B

KDELR2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human KDELR2

Mouse monoclonal KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PDIA4 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the N terminal of human PDIA4. Synthetic peptide located within the following region: ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL

Rabbit Polyclonal Anti-SLC12A2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 19 amino acid peptide from N-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (89%); Monkey, Marmoset, Ferret, Dog, Panda (84%).

Rabbit Polyclonal Anti-SLC12A2 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 18 amino acid peptide from internal region of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Bovine, Pig (89%); Ferret, Dog, Bat, Panda (83%).

Rabbit Polyclonal Anti-SLC12A2 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Bovine, Dog, Bat, Hamster, Panda, Horse, Pig (100%); Elephant, Lizard (94%); Opossum, Chicken (88%); Turkey (82%).

Rabbit Polyclonal Anti-SLC12A2 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Elephant, Panda, Bovine, Dog, Horse, Pig, Opossum, Guinea pig (100%); Bat (93%).

Carrier-free (BSA/glycerol-free) PDIA4 mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDIA4 mouse monoclonal antibody, clone OTI2A11 (formerly 2A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDIA4 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-CFTR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator

Anti-CFTR Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator

Rabbit Polyclonal Anti-ADCY3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ADCY3

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNQ1

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2C11 (formerly 2C11), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2C11 (formerly 2C11), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2A11 (formerly 2A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2A11 (formerly 2A11), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2A11 (formerly 2A11), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2A11 (formerly 2A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated