Rabbit polyclonal C-RAF (Thr269) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human C-RAF around the phosphorylation site of threonine 269 (S-T-TP-L-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal ATF4(Ab-245) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human ATF4 around the phosphorylation site of Serine 245. |
Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K). |
Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
Anti-MAP2K2 (Phospho-Thr394) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 394 (P-G-T(p)-P-T) derived from Human MEK-2. |
| Modifications | Phospho-specific |
Anti-RPS6KA1 (Phospho-Thr348) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 348 (S-R-T(p)-P-R) derived from Human RPS6KA1. |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit polyclonal MAPK1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1. |
Rabbit polyclonal NRAS Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-179 amino acids from the C-terminal region of human NRAS. |
Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2). |
Rabbit polyclonal PLCB2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2. |
Rabbit polyclonal B-RAF (Phospho-Thr599) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-Raf around the phosphorylation site of threonine 598 (L-A-TP-V-K). |
| Modifications | Phospho-specific |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A purified peptide conjugated to KLH |
Rabbit polyclonal Raf1 (Ser621) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-SP-E-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLC-beta (Ser1105) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLC-β around the phosphorylation site of serine 1105 (N-N-SP-I-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CREBBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CREBBP Antibody: synthetic peptide directed towards the N terminal of human CREBBP. Synthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit polyclonal anti-GRM1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRM1. |
Rabbit polyclonal anti-S6K-a2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human S6K-a2. |
Rabbit polyclonal CaMK2 alpha/beta/delta antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CaMK2a/β/d. |
Rabbit polyclonal anti-CALML5 (CABP7) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CALML5. |
Rabbit anti mGluR5 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rabbit, Rat |
| Immunogen | A synthetic peptide derived from C-terminus of human Glutamate receptor. This sequence is identical to human and rat. |
Rabbit anti ERK2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of ERK2 protein from human, rat, mouse and dog origins. |
Rabbit anti CaM Kinase IV Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide from aa 457-474 of rat CaM Kinase IV. |
Anti-GRM1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1 |
Anti-PPP1CB Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Anti-PRKCA rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha |
Anti-MAP2K1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1 |
Anti-MAP2K2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 20-34 amino acids of Human mitogen-activated protein kinase kinase 2 |
Anti-ADCY1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1057-1070 amino acids of human adenylate cyclase 1 (brain) |
Anti-CREBBP Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 160-176 amino acids of Human |
Anti-PRKACG Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 44-298 amino acids of human protein kinase, cAMP-dependent, catalytic, gamma |
Germany
Japan
United Kingdom
China
