Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 9 of 9 results

(reset)

alpha Actinin (ACTN1) Rabbit Polyclonal Antibody

TA344352

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

alpha Actinin (ACTN1) Rabbit Polyclonal Antibody

TA326960

USD 275.00

3 Weeks

Rabbit anti-ACTN1 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Monkey
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ACTN1

1 / 3

2 / 3

3 / 3

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: SA-20]

AM20694PU-N

USD 405.00

2 Weeks

alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse, Rabbit, Rat

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

CF500072

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) alpha-actinin mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

alpha Actinin (ACTN1) Rabbit Polyclonal Antibody

TA321277

USD 345.00

In Stock

Anti-ACTN1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

TA500072

USD 379.00

In Stock

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A4]

TA500072AM

USD 420.00

4 Weeks

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A4]

TA500072BM

USD 420.00

4 Weeks

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

TA500072S

USD 159.00

In Stock

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 9 of 9 results