Antibodies

View as table Download

Rabbit Polyclonal Anti-KHK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the C terminal of human KHK. Synthetic peptide located within the following region: FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI4E9 (formerly 4E9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3C4 (formerly 3C4), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4E9 (formerly 4E9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4E9 (formerly 4E9), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4E9 (formerly 4E9), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4E9 (formerly 4E9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3D1 (formerly 3D1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3D1 (formerly 3D1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".