Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 91 results

Page 1 of 2

(reset)

DPAGT1 Rabbit Polyclonal Antibody

TA319635

USD 430.00

5 Days

Rabbit Polyclonal DPAGT1 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1.

1 / 3

2 / 3

3 / 3

Previous Next

CD75 (ST6GAL1) Rabbit Polyclonal Antibody

TA314536

USD 345.00

In Stock

Rabbit polyclonal anti-ST6GAL1 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human ST6GAL1.

1 / 2

2 / 2

Previous Next

MGAT3 Rabbit Polyclonal Antibody

TA307945

USD 415.00

In Stock

Rabbit Polyclonal antibody to MGAT3 (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 260 and 525 of MGAT3 (Uniprot ID#Q09327)

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin II (RPN2) Rabbit Polyclonal Antibody

TA590669

USD 409.00

In Stock

Rabbit Polyclonal Ribophorin II Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 3

2 / 3

3 / 3

Previous Next

B4GALT3 Rabbit Polyclonal Antibody

TA314795

USD 345.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.

1 / 2

2 / 2

Previous Next

CD75 (ST6GAL1) Rabbit Polyclonal Antibody

AP31619PU-N

USD 440.00

2 Weeks

CD75 (ST6GAL1) rabbit polyclonal antibody, Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to the Internal region of Human ST6GAL1.

1 / 2

2 / 2

Previous Next

FUT8 (Center) Rabbit Polyclonal Antibody

AP51742PU-N

USD 450.00

2 Weeks

FUT8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 329-357 amino acids from the Central region of Human Fucosyltransferase 8

1 / 2

2 / 2

Previous Next

MAN2A2 (Center) Rabbit Polyclonal Antibody

AP52594PU-N

USD 450.00

2 Weeks

MAN2A2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 766-796 amino acids from the Central region of human MAN2A2

1 / 3

2 / 3

3 / 3

Previous Next

alpha Glucosidase II (GANAB) Rabbit Polyclonal Antibody

TA308534

USD 415.00

5 Days

Rabbit Polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein fragment contain a sequence corresponding to a region within amino acids 47 and 251 of alpha Glucosidase II

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALG10 (N-term) Rabbit Polyclonal Antibody

AP50145PU-N

USD 450.00

2 Weeks

ALG10 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 17~43 amino acids from the N-terminal region of human ALG10

1 / 2

2 / 2

Previous Next

RFT1 (C-term) Rabbit Polyclonal Antibody

AP53640PU-N

USD 450.00

2 Weeks

RFT1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 520-549 amino acids from the C-terminal region of Human RFT1

1 / 2

2 / 2

Previous Next

MAN1B1 Rabbit Polyclonal Antibody

TA307927

USD 415.00

5 Days

Rabbit polyclonal antibody to MAN1B1 (mannosidase, alpha, class 1B, member 1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 414 and 699 of MAN1B1 (Uniprot ID#Q9UKM7)

1 / 2

2 / 2

Previous Next

alpha Glucosidase II (GANAB) Rabbit Polyclonal Antibody

TA308533

USD 415.00

5 Days

Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697)

1 / 2

2 / 2

Previous Next

ALG11 Rabbit Polyclonal Antibody

TA335312

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALG11 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ALG11 antibody: synthetic peptide directed towards the C terminal of human ALG11. Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES

1 / 2

2 / 2

Previous Next

MGAT2 Rabbit Polyclonal Antibody

TA335833

USD 310.00

5 Days

Rabbit Polyclonal Anti-MGAT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-MGAT2 Antibody: synthetic peptide directed towards the middle region of human MGAT2. Synthetic peptide located within the following region: PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD

1 / 2

2 / 2

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

CF503648

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

CF503649

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI6A9]

CF503651

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI5B1]

CF503655

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI2E3]

CF503666

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ALG2 Mouse Monoclonal Antibody [Clone ID: OTI2A3]

CF504217

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALG2 Mouse Monoclonal Antibody [Clone ID: OTI1E7]

CF504218

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ALG2 Mouse Monoclonal Antibody [Clone ID: OTI3C2]

CF504242

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ribophorin II (RPN2) Mouse Monoclonal Antibody [Clone ID: OTI1G9]

CF504604

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RPN2 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

DDOST Mouse Monoclonal Antibody [Clone ID: OTI1C1]

CF803614

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

DDOST Mouse Monoclonal Antibody [Clone ID: OTI2H2]

CF803618

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

DDOST Mouse Monoclonal Antibody [Clone ID: OTI2H1]

CF803619

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

DDOST Mouse Monoclonal Antibody [Clone ID: OTI2B4]

CF803634

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) DDOST mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

ALG2 Rabbit Polyclonal Antibody

TA322120

USD 345.00

In Stock

Anti-ALG2 Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human ALG2, alpha-1,3/1,6-mannosyltransferase

ALG2 Rabbit Polyclonal Antibody

TA322121

USD 345.00

In Stock

Anti-ALG2 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human ALG2, alpha-1,3/1,6-mannosyltransferase

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALG12 Rabbit Polyclonal Antibody

TA322185

USD 345.00

In Stock

Anti-ALG12 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 367-488 amino acids of human ALG12, alpha-1,6-mannosyltransferase

ALG12 Rabbit Polyclonal Antibody

TA322186

USD 345.00

In Stock

Anti-ALG12 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 367-488 amino acids of human ALG12, alpha-1,6-mannosyltransferase

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALG9 Rabbit Polyclonal Antibody

TA323315

USD 345.00

In Stock

Anti-ALG9 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 427-611 amino acids of human ALG9, alpha-1,2-mannosyltransferase

ALG9 Rabbit Polyclonal Antibody

TA323316

USD 345.00

In Stock

Anti-ALG9 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 427-611 amino acids of human ALG9, alpha-1,2-mannosyltransferase

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALG8 Rabbit Polyclonal Antibody

TA323479

USD 345.00

In Stock

Anti-ALG8 Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 25-122 amino acids of human ALG8, alpha-1,3-glucosyltransferase

Ribophorin I (RPN1) Rabbit Polyclonal Antibody

TA349562

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-RPN1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human RPN1

ALG11 Rabbit Polyclonal Antibody

TA350849

USD 345.00

In Stock

Rabbit Polyclonal Anti-ALG11 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human ALG11

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

FUT8 Rabbit Polyclonal Antibody

TA351201

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-FUT8 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human FUT8

Ribophorin II (RPN2) Rabbit Polyclonal Antibody

TA356522

USD 360.00

5 Days

RPN2 Antibody - N-terminal region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human RPN2

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

TA503648

USD 379.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H3]

TA503648AM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H3]

TA503648BM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

TA503648S

USD 159.00

2 Days

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

TA503649

USD 379.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]

TA503649AM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E1]

TA503649BM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

TA503649S

USD 159.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI6A9]

TA503651

USD 379.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A9]

TA503651AM

USD 420.00

5 Days

RPN1 mouse monoclonal antibody,clone 6A9, Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A9]

TA503651BM

USD 420.00

5 Days

RPN1 mouse monoclonal antibody,clone 6A9, HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

1 - 50 of 91 results

Page 1 of 2