Antibodies

Jump to Filters
View as table Download
RICTOR (1-99) Mouse Monoclonal Antibody [Clone ID: 1F3]
AM31901PU-N

USD 480.00

2 Weeks

RICTOR (1-99) mouse monoclonal antibody, clone 1F3, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
RICTOR Mouse Monoclonal Antibody [Clone ID: 7B3]
TA336802

USD 424.00

5 Days

Mouse Monoclonal Rictor Antibody (7B3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
TA336802 is a replacement of AM06499SU-N.
RICTOR Rabbit Polyclonal Antibody
TA308477

USD 415.00

5 Days

Rabbit polyclonal antibody to RICTOR

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1648 and 1708 of RICTOR (Uniprot ID#Q6R327)
RICTOR Goat Polyclonal Antibody
TA303018

USD 375.00

5 Days

Goat Polyclonal Antibody against RICTOR

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KQPIVDTSAES, from the C Terminus of the protein sequence according to NP_689969.2.
RICTOR Rabbit Polyclonal Antibody
TA349591

USD 345.00

In Stock

Rabbit Polyclonal Anti-RICTOR Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR
RICTOR Rabbit Polyclonal Antibody
TA357866

USD 360.00

5 Days

RICTOR Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG