Rabbit Polyclonal Anti-IRF6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRF6 |
Rabbit Polyclonal Anti-IRF6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRF6 |
IRF6 (455-467) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from C-term of human IRF6 |
Goat Polyclonal Antibody against IRF6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TPSMQLPPALPPQ, from the C Terminus of the protein sequence according to NP_006138. |
Rabbit Polyclonal Anti-IRF6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the middle region of human IRF6. Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ |
Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FKBP6 Antibody - middle region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FKBP6 |
IRF6 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRF6 |
IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Biotin |
IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | HRP |
IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
IRF6 mouse monoclonal antibody,clone UMAB106
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody,clone UMAB106
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
IRF6 mouse monoclonal antibody,clone UMAB106
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".