Antibodies

Jump to Filters
View as table Download
PTCH1 (C-term) Goat Polyclonal Antibody
AP22448PU-N

USD 375.00

5 Days

PTCH1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1)
PTCH1 (1431-1442) Goat Polyclonal Antibody
AP23037PU-N

USD 440.00

2 Weeks

PTCH1 (1431-1442) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bat, Canine, Equine, Human, Monkey
Immunogen Synthetic peptide from C-terminus of human PTCH1
PTCH1 Rabbit Polyclonal Antibody
TA334665

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTCH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]
CF500123

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) Patched1 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTCH1 Rabbit Polyclonal Antibody
TA380484

USD 220.00

3 Weeks

PTCH1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1214-1312 of human PTCH1 (NP_000255.2).
Modifications Unmodified
PTCH1 Rabbit Polyclonal Antibody
TA385073

USD 380.00

4 Weeks

PTCH1 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Patched. AA range:1-50
PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]
TA500123

USD 379.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTCH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C7]
TA500123AM

USD 420.00

4 Weeks

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PTCH1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C7]
TA500123BM

USD 420.00

4 Weeks

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]
TA500123S

USD 159.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated