Antibodies

View as table Download

MORF4L2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MORF4L2

Rabbit Polyclonal Anti-MORF4L2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MORF4L2 antibody: synthetic peptide directed towards the N terminal of human MORF4L2. Synthetic peptide located within the following region: PPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFK

Rabbit Polyclonal Anti-MORF4L2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MORF4L2 antibody: synthetic peptide directed towards the N terminal of human MORF4L2. Synthetic peptide located within the following region: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN

MORF4L2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MORF4L2

MORF4L2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MORF4L2 (NP_001135890.1).
Modifications Unmodified