Antibodies

View as table Download

SCD rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCD

Rabbit Polyclonal Anti-SCD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

SCD1 (SCD) mouse monoclonal antibody, clone CD.E10, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Human, Mouse

SCD1 (SCD) (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC
Reactivities Human
Immunogen Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3.

SCD1 (SCD) (354-366) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Synthetic peptide from C-terminus of human SCD

Rabbit Polyclonal Anti-SCD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCD

SCD Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SCD (NP_005054.3).
Modifications Unmodified