Goat Polyclonal Anti-tdTomato Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-tdTomato Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Peroxidase Conjugated Affinity Purified Goat anti-Mouse IgG [H&L]
Applications | WB: 1: 1,000; ICC: 1:200; IP: 1:200 |
Reactivities | Mouse IgG |
Conjugation | HRP |
Immunogen | Mouse IgG, whole molecule |
Goat Polyclonal Anti-ZO1 Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli. |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Anti-6X His tag rabbit polyclonal antibody
Applications | ELISA, IP, WB |
Immunogen | Rabbit Polyclonal antibody to 6X His tag |
Rabbit Polyclonal tdTomato Antibody
Applications | WB |
Immunogen | tdTomato |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Rabbit Polyclonal mCherry Antibody
Applications | WB |
Immunogen | mCherry |
Rabbit Polyclonal turboGFP Antibody
Applications | WB |
Immunogen | Purified tGFP protein expressed in E. coli. |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Rabbit Anti-Mouse IgG Secondary Antibody
Applications | WB, IHC, IF/ICC, ELISA |
Reactivities | Mouse IgG |
Conjugation | Unconjugated |
Immunogen | Mouse IgG, whole molecule |
Chicken Polyclonal turboGFP Antibody
Applications | WB |
Immunogen | Purified tGFP protein expressed in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-RFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant RFP peptide produced in E. coli. |
Rabbit Polyclonal mKate Antibody
Applications | WB |
Immunogen | Purified mKate protein expressed in E. coli. |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
Anti-DDK (FLAG) rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (DYKDDDDK) conjugated to KLH |
Rabbit Polyclonal mGFP Antibody
Applications | WB |
Immunogen | mGFP |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Goat Polyclonal tdTomato Antibody
Applications | WB |
Immunogen | tdTomato |
Anti-Dendra2 rabbit polyclonal antibody
Applications | WB |
Immunogen | Purified Dendra2 protein expressed in E. coli. |
LYVE1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure recombinant Human soluble LYVE-1 produced in insect cells (Cat.-No DA3525). It consists of amino acid 24 (Ser) to 232 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Anti-MYC tag rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (EQKLISEEDL) conjugated to KLH |
Chicken Polyclonal mGFP Antibody
Applications | WB |
Immunogen | mGFP |
Anti-His tag rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (HHHHHH) conjugated to KLH |
Goat Polyclonal turboGFP Antibody
Applications | WB |
Immunogen | Purified tGFP protein expressed in E. coli. |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Goat Polyclonal mCherry Antibody
Applications | WB |
Immunogen | mCherry |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit Polyclonal eGFP Antibody
Applications | WB |
Immunogen | Purified eGFP protein expressed in E. coli. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Goat Polyclonal mPlum Antibody
Applications | WB |
Immunogen | Purified mPlum protein expressed in E. coli. |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
EPO (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 20-48 amino acids from the N-terminal region of Human Erythropoietin. |
Chicken Polyclonal mKate Antibody
Applications | WB |
Immunogen | Purified mKate protein expressed in E. coli. |
Anti-MYC tag chicken polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (EQKLISEEDL) conjugated to KLH |
Rabbit Polyclonal Anti-EGFLAM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |