Antibodies

View as table Download

Rabbit Polyclonal TCF3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TCF3 antibody was raised against a 17 amino acid peptide near the amino terminus of human TCF3.

Rabbit polyclonal anti-TCF3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TCF3.

Goat Polyclonal Antibody against TCF3 / ITF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KAPRARTSPDEDED, from the internal region of the protein sequence according to NP_003191.1.

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the C terminal of human TCF3. Synthetic peptide located within the following region: EENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVAN

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF3 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF3. Synthetic peptide located within the following region: EDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGG

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the N terminal of human TCF3. Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL