Rabbit Polyclonal TCF3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCF3 antibody was raised against a 17 amino acid peptide near the amino terminus of human TCF3. |
Rabbit Polyclonal TCF3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCF3 antibody was raised against a 17 amino acid peptide near the amino terminus of human TCF3. |
Rabbit polyclonal anti-TCF3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TCF3. |
Goat Polyclonal Antibody against TCF3 / ITF1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KAPRARTSPDEDED, from the internal region of the protein sequence according to NP_003191.1. |
Rabbit Polyclonal Anti-TCF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the C terminal of human TCF3. Synthetic peptide located within the following region: EENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVAN |
Rabbit Polyclonal Anti-TCF3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF3 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF3. Synthetic peptide located within the following region: EDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGG |
Rabbit Polyclonal Anti-TCF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the N terminal of human TCF3. Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL |