Antibodies

Jump to Filters
View as table Download
KDM4C Rabbit Polyclonal Antibody
TA309711

USD 457.00

5 Days

Rabbit Polyclonal JMJD2C Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human JMJD2C protein (within residues 450-600). [Swiss-Prot Q9H3R0]
KDM4C (C-term) Rabbit Polyclonal Antibody
AP52272PU-N

USD 450.00

2 Weeks

KDM4C (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1030-1056 amino acids from the C-terminal region of human JMJD2C
KDM4C Rabbit Polyclonal Antibody
TA347228

USD 315.00

5 Days

Rabbit Polyclonal JMJD2c Antibody

Applications ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-JMJD2c antibody: human JMJD2c (Jumonji Domain containing 2c), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein.
KDM4C Rabbit Polyclonal Antibody
TA332172

USD 375.00

5 Days

Rabbit Polyclonal Anti-JMJD2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JMJD2C Antibody: synthetic peptide directed towards the middle region of human JMJD2C. Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR
KDM4C Mouse Monoclonal Antibody [Clone ID: OTI5B9]
CF500567

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
KDM4C Mouse Monoclonal Antibody [Clone ID: OTI8A1]
CF500588

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
KDM4C Rabbit Polyclonal Antibody
TA351311

USD 345.00

In Stock

Rabbit Polyclonal Anti-KDM4C Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KDM4C
KDM4C Mouse Monoclonal Antibody [Clone ID: OTI5B9]
TA500567

USD 379.00

In Stock

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
KDM4C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]
TA500567AM

USD 420.00

4 Weeks

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Biotin
KDM4C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B9]
TA500567BM

USD 420.00

4 Weeks

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation HRP
KDM4C Mouse Monoclonal Antibody [Clone ID: OTI5B9]
TA500567S

USD 159.00

2 Days

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
KDM4C Mouse Monoclonal Antibody [Clone ID: OTI8A1]
TA500588

USD 379.00

In Stock

Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
KDM4C Mouse Monoclonal Antibody [Clone ID: OTI8A1]
TA500588S

USD 159.00

2 Days

Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated