Mouse anti-ABCA1 monoclonal antibody
Applications | WB |
Reactivities | Chicken, Human, Mouse |
Conjugation | Unconjugated |
Mouse anti-ABCA1 monoclonal antibody
Applications | WB |
Reactivities | Chicken, Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal ABCA1 Antibody (HJ1) - Astrocyte Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal ABCA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
ABCA1 (1800-2260) mouse monoclonal antibody, clone AB1.G6, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
ABCA1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCA1 |
Rabbit anti-ABCA1 polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCA1. |
Anti-ABCA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1. |
Rabbit Polyclonal Anti-Abca1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK |
ABCA1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1870-2120 of human ABCA1 (NP_005493.2). |
Modifications | Unmodified |
ABCA1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1870-2120 of human ABCA1 (NP_005493.2). |
Modifications | Unmodified |