Rabbit Polyclonal JMJD2C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human JMJD2C protein (within residues 450-600). [Swiss-Prot Q9H3R0] |
Rabbit Polyclonal JMJD2C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human JMJD2C protein (within residues 450-600). [Swiss-Prot Q9H3R0] |
KDM4C (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1030-1056 amino acids from the C-terminal region of human JMJD2C |
Rabbit Polyclonal JMJD2c Antibody
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-JMJD2c antibody: human JMJD2c (Jumonji Domain containing 2c), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein. |
Rabbit Polyclonal Anti-JMJD2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JMJD2C Antibody: synthetic peptide directed towards the middle region of human JMJD2C. Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR |
Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KDM4C Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KDM4C |
KDM4C Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-570 of human KDM4C (NP_055876.2). |
Modifications | Unmodified |
Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |