Antibodies

View as table Download

Mouse Monoclonal Antibody against TRA-1-81 (TRA-1-81) - Embryonic Stem Cell Marker

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Antibody against TRA-1-60 (TRA-1-60(R)) -Neuraminidase resistant -Embryonic Stem Cell Marker

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Podocalyxin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide within an internal region (residues 100-200) of the human Podocalyxin protein. [Swiss-Prot# O00592] This immunogen should be far enough away from any glycosylation site.

Rabbit Polyclonal Anti-PODXL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PODXL Antibody: synthetic peptide directed towards the middle region of human PODXL. Synthetic peptide located within the following region: PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ

Goat Polyclonal Antibody against PODXL

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DNLTKDDLDEEEDTH, from the C Terminus of the protein sequence according to NP_001018121.1 ; NP_005388.2.

Rabbit Polyclonal Anti-PODXL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PODXL Antibody: synthetic peptide directed towards the N terminal of human PODXL. Synthetic peptide located within the following region: TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT

Carrier-free (BSA/glycerol-free) PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PODXL Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 287-526 of human PODXL (NP_005388.2).
Modifications Unmodified

PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated