Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit Polyclonal Anti-Claudin 2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 2 Antibody: A synthesized peptide derived from human Claudin 2 |
Goat Polyclonal Anti-CD31 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli. |
Rabbit Polyclonal Antibody against CDH3 (C-term)
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 660-688 amino acids from the C-terminal region of human CDH3. |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
| Modifications | Phospho-specific |
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
Rabbit Polyclonal Anti-CLDN11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
Rabbit Polyclonal Anti-CD276 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CD276 antibody was raised against a peptide corresponding to 19 amino acids near the carboxy terminus of CD276. The immunogen is located within amino acids 484 - 534 of CD276. |
Germany
Japan
United Kingdom
China
