Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit Polyclonal Anti-G6pc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3

AKT3 mouse monoclonal antibody, clone OTI9B2 (formerly 9B2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AKT3 mouse monoclonal antibody, clone OTI9B2 (formerly 9B2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

JNK1 (MAPK8) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

JNK1 (MAPK8) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-JNK1 (JNK1) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-JNK1 (JNK1) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AKT1 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

AKT1 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

MAPK3 (ERK1) mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

MAPK3 (ERK1) mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated