Antibodies

View as table Download

Rabbit polyclonal anti-AIFM1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIFM1.

Rabbit Polyclonal Anti-PDCD8 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the C terminal of human PDCD8. Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST

Goat Polyclonal Anti-Aurora Kinase B Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aurora Kinase B Antibody: Peptide with sequence YKELQKSCTFDEQ, from the internal region of the protein sequence according to NP_004208.2.

Rabbit anti-AIFM1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AIFM1

Rabbit Polyclonal AIF Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen AIF antibody was raised against a peptide corresponding to amino acids near the amino terminus of mature human AIF. The immunogen is located within amino acids 90 - 140 of AIF.

Rabbit Polyclonal AIF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AIF antibody was raised against a peptide corresponding to amino acids 517 to 531 of human AIF. This sequence is identical to those of mouse and rat AIF.

Rabbit Polyclonal Anti-AIFM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the N terminal of human PDCD8. Synthetic peptide located within the following region: GAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPS

Rabbit Polyclonal AIF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine
Conjugation Unconjugated
Immunogen (aa 151-170); human

Rabbit Polyclonal Anti-AIFM1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-AIFM1 antibody: synthetic peptide directed towards the middle region of human AIFM1. Synthetic peptide located within the following region: VIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Anti-AIFM1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1

Anti-AIFM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1