Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Equine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Equine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against PTGDS
Applications | WB |
Reactivities | Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog |
Conjugation | Unconjugated |
Immunogen | The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222] |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal SR1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 45-76 of human Sorcin was used as immunogen, GenBank no NP-003121. |
Rabbit Polyclonal beta-Arrestin 2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Rabbit Polyclonal GRAIL/RNF128 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
Rabbit Polyclonal NFkB p65 NLS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Rabbit Polyclonal TRBP Antibody
Applications | IHC, WB |
Reactivities | Human, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 340-390 of human TRBP was used as the immunogen. |
Rabbit Polyclonal RUNX2/CBFA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Chicken, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to somewhere between amino acids 250-300 of human RUNX2 was used as immunogen for this antibody.RUNX2 and RUNX1 share an approximate 66% homology in peptide sequence used as immunogen. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
Applications | IHC, WB |
Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal NLRX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 580-630 of human NLRX1 was used as the immunogen for the antibody. |
Rabbit Polyclonal Spi-B Antibody
Applications | WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 15-65 of human Spi-B was used as the immunogen. |
Rabbit Polyclonal CUEDC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 250-300 of human CUEDC2 was used as the immunogen. |
Rabbit Polyclonal SUMO3 Antibody
Applications | WB |
Reactivities | Equine, Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-95 of human SUMO3 (SMT3) was used as the immunogen for this antibody. |
Rabbit Polyclonal Gastrokine 1 Antibody
Applications | WB |
Reactivities | Human, Equine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen. |
Rabbit Polyclonal Snail Antibody
Applications | WB |
Reactivities | Human, Mouse, Canine, Equine |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 80-130 of human SNAI1 was used as the immunogen |