Rabbit anti-BMI1 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMI1 |
Rabbit anti-BMI1 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMI1 |
Rabbit Polyclonal Antibody against Bmi1
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region (within residues 1-100) of the human Bmi1 protein. [Swiss-Prot# P35226] |
Rabbit Polyclonal BMI-1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | BMI-1 antibody was raised against a peptide corresponding to 15 amino acids near the center of human BMI-1. |
Rabbit polyclonal BMI1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | This BMI1 antibody is generated from rabbits immunized with BMI1 recombinant protein. |
Goat polyclonal anti-BMI1 antibody
Applications | IF, WB |
Reactivities | Human |
Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 252-264 of human Bmi1 protein. |
Rabbit Polyclonal Anti-BMI1 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-PCGF4 Antibody: synthetic peptide directed towards the C terminal of human PCGF4. Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
Rabbit Polyclonal Anti-BMI1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BMI1 |
Bmi1 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
BMI1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BMI1 |
Bmi1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-326 of human Bmi1 (NP_005171.4). |
Modifications | Unmodified |