Antibodies

Jump to Filters
View as table Download
CRMP1 Rabbit Polyclonal Antibody
TA346284

USD 475.00

5 Days

Rabbit Polyclonal Anti-CRMP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV
CRMP1 Rabbit Polyclonal Antibody
TA306259

USD 430.00

In Stock

Rabbit Polyclonal CRMP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CRMP1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human CRMP1.
CRMP1 Rabbit Polyclonal Antibody
TA346283

USD 475.00

5 Days

Rabbit Polyclonal Anti-CRMP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI
CRMP1 Rabbit Polyclonal Antibody
TA346285

USD 475.00

5 Days

Rabbit Polyclonal Anti-CRMP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the C terminal of human CRMP1. Synthetic peptide located within the following region: SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS
CRMP1 (N-term) Rabbit Polyclonal Antibody
AP22678PU-N

USD 440.00

2 Weeks

CRMP1 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen CRMP1 antibody was raised against cRMP1 antibody was raised against an 18 amino acid peptide from near the amino terminus of human CRMP1.
CRMP1 Rabbit Polyclonal Antibody
TA306260

USD 430.00

5 Days

Rabbit Polyclonal CRMP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CRMP1 antibody was raised against a 16 amino acid peptide from near the center of human CRMP1.
CRMP1 Rabbit Polyclonal Antibody
TA306707

USD 430.00

5 Days

Rabbit Polyclonal CRMP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CRMP1 antibody was raised against a 18 amino acid peptide from near the amino terminus of human CRMP1.
CRMP1 Rabbit Polyclonal Antibody
TA321326

USD 345.00

In Stock

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 507-522 amino acids of Human collapsin response mediator protein 1
CRMP1 Rabbit Polyclonal Antibody
TA323438

USD 345.00

In Stock

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 249 amino acids of human collapsin response mediator protein 1
CRMP1 Rabbit Polyclonal Antibody
TA323439

USD 345.00

4 Weeks

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 506-522 amino acids of Human Collapsin response mediator protein 1
Crmp1 Rabbit Polyclonal Antibody
TA363275

USD 360.00

5 Days

CRMP1 Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse CRMP1
CRMP1 Rabbit Polyclonal Antibody
TA375104

USD 220.00

3 Weeks

CRMP1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CRMP1
Modifications Unmodified