Rabbit Polyclonal NOD5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOD5 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human NOD5. |
Rabbit Polyclonal NOD5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOD5 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human NOD5. |
Rabbit Polyclonal NLRX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 580-630 of human NLRX1 was used as the immunogen for the antibody. |
Goat Anti-NLRX1 / NOD9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NFSGETLDSTDPSN, from the internal region of the protein sequence according to NP_078894.2; NP_733840.1. |
Rabbit Polyclonal Anti-NLRX1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRX1. Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ |
Rabbit Polyclonal Anti-NLRX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the C-terminal region of Human NLRX1. Synthetic peptide located within the following region: SEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQL |
NLRX1 Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 87-360 of human NLRX1 (NP_001269073.1). |
Modifications | Unmodified |