Antibodies

View as table Download

Rabbit Polyclonal NOD5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOD5 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human NOD5.

Rabbit Polyclonal NLRX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 580-630 of human NLRX1 was used as the immunogen for the antibody.

Goat Anti-NLRX1 / NOD9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NFSGETLDSTDPSN, from the internal region of the protein sequence according to NP_078894.2; NP_733840.1.

Rabbit Polyclonal Anti-NLRX1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRX1. Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ

Rabbit Polyclonal Anti-NLRX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the C-terminal region of Human NLRX1. Synthetic peptide located within the following region: SEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQL

NLRX1 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 87-360 of human NLRX1 (NP_001269073.1).
Modifications Unmodified