Rabbit Polyclonal Anti-UBD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | UBD antibody was raised against a 16 amino acid peptide near the center of human UBD. |
Rabbit Polyclonal Anti-UBD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | UBD antibody was raised against a 16 amino acid peptide near the center of human UBD. |
Rabbit Polyclonal Anti-SLCO1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SLCO1B1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLCO1B1. |
Rabbit polyclonal anti-UBD antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human UBD |
Rabbit Polyclonal Anti-UBD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBD antibody: synthetic peptide directed towards the N terminal of human UBD. Synthetic peptide located within the following region: RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE |
FAT10/UBD Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human FAT10/FAT10/UBD (NP_006389.2). |
Modifications | Unmodified |