Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CXCR4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Rabbit polyclonal anti-Neuropilin-1 antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 816 of mouse Neuropilin 1 |
Rabbit anti-NRP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NRP1 |
Rabbit polyclonal EPHA3 (Ab-602) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPHA3. |
Goat Anti-UNC5B (aa629-643) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SARDWIFQLKTQAHQ, from the internal region of the protein sequence according to NP_734465.2. |
Rabbit Polyclonal Anti-EPHA7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA7 Antibody: A synthesized peptide derived from human EPHA7 |
Rabbit Polyclonal Anti-EPHA3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA3 Antibody: A synthesized peptide derived from human EPHA3 |
Rabbit polyclonal c-Met (Ab-1003) antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Tyr1003, Mouse: Tyr1001, Rat: Tyr1004 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-EPHA3 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA3. |
Rabbit polyclonal Ephrin B1/B2/B3 (Tyr324) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ephrin B1/B2/B3 around the phosphorylation site of tyrosine 324 (G-D-YP-G-H). |
| Modifications | Phospho-specific |
Rabbit anti-EFNB2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EFNB2 |
Rabbit Polyclonal Anti-EPHA2/3/4 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA2/3/4 Antibody: A synthesized peptide derived from human EPHA2/3/4 |
Rabbit Polyclonal Anti-EPHA5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA5 Antibody: A synthesized peptide derived from human EPHA5 |
Rabbit Polyclonal Anti-EPHB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHB1 Antibody: A synthesized peptide derived from human EPHB1 |
Rabbit Polyclonal Anti-Integrin β1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin β1 Antibody: A synthesized peptide derived from human Integrin β1 |
Rabbit Polyclonal Anti-EPHA4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA4 Antibody: A synthesized peptide |
Rabbit Polyclonal Anti-Phospho-EPHA2/3(Tyr588/596) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-EPHA2/3(Tyr588/596) Antibody: A synthesized peptide derived from human EPHA2/3 around the phosphorylation site of Tyrosine 588 and 596 |
| Modifications | Phospho-specific |
Rabbit polyclonal Met (Ab-1234) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Met around the phosphorylation site of tyrosine 1234 (K-E-YP-Y-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta1 (Ab-789) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Rabbit polyclonal anti-EPHA5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA5. |
Rabbit polyclonal anti-EPHA7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA7. |
Rabbit polyclonal anti-EPHB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EPHB1. |
Rabbit Polyclonal EFNB1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EFNB1/2 |
Rabbit Polyclonal EFNB1/2 (Tyr330) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EFNB1/2 around the phosphorylation site of Tyrosine 330 |
| Modifications | Phospho-specific |
Rabbit Polyclonal c-Met Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Met |
Rabbit Polyclonal Met Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Met |
Rabbit Polyclonal c-Met (Tyr1003) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Met around the phosphorylation site of Tyrosine 1003 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Met (Tyr1234) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Met around the phosphorylation site of Tyrosine 1234 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Met (Tyr1349) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Met around the phosphorylation site of Tyrosine 1349 |
| Modifications | Phospho-specific |
Rabbit polyclonal ITGB1 (Tyr795) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITGB1 around the phosphorylation site of tyrosine 795 (P-K-YP-E-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal EPHA7 (Tyr791) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EPHA7around the phosphorylation site of tyrosine 791. |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Met phospho Y1349 / Y1356 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y1349 and Y1356 of human c-Met protein. |
Rabbit Polyclonal Anti-NTN4 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTN4 antibody: synthetic peptide directed towards the N terminal of human NTN4. Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY |
Goat Polyclonal Antibody against EPHB2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKDRNHRPKFGQ, from the internal region of the protein sequence according to NP_004433.2; NP_059145.2. |
Goat Anti-Netrin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KFQQREKKGKCKKA, from the C Terminus of the protein sequence according to NP_004813.2. |
Rabbit anti-EFNB2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanEphrin-B2 around the phosphorylation site of tyrosine 316 (P-V-YP-I-V). |
Rabbit polyclonal Met (Tyr1349) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Met around the phosphorylation site of tyrosine 1349 (E-H-YP-V-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal SEMA6B Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This SEMA6B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 830-859 amino acids from the C-terminal region of human SEMA6B. |
Rabbit Polyclonal Anti-SEMA6A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SEMA6A |
Active filters
Reactivities
- Rat
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Axon guidance