Antibodies

View as table Download

Rabbit Polyclonal Anti-CRMP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV

Rabbit Polyclonal CRMP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CRMP1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human CRMP1.

Rabbit Polyclonal Anti-CRMP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI

Rabbit Polyclonal Anti-CRMP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the C terminal of human CRMP1. Synthetic peptide located within the following region: SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS

Rabbit Polyclonal CRMP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CRMP1 antibody was raised against a 16 amino acid peptide from near the center of human CRMP1.

Rabbit Polyclonal CRMP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CRMP1 antibody was raised against a 18 amino acid peptide from near the amino terminus of human CRMP1.

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 507-522 amino acids of Human collapsin response mediator protein 1

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 249 amino acids of human collapsin response mediator protein 1

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 506-522 amino acids of Human Collapsin response mediator protein 1

CRMP1 Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse CRMP1

CRMP1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CRMP1
Modifications Unmodified