Antibodies

Jump to Filters
View as table Download
IL33 Mouse Monoclonal Antibody [Clone ID: 12H6D12]
TA320070

USD 430.00

5 Days

Mouse IL-33 Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
IL33 Rabbit Polyclonal Antibody
TA306448

USD 430.00

2 Weeks

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the center of human IL-33.
IL33 Rabbit Polyclonal Antibody
TA306447

USD 430.00

5 Days

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the amino terminus of human IL-33.
IL33 Rabbit Polyclonal Antibody
TA339875

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
IL33 Rabbit Polyclonal Antibody
TA319221

USD 540.00

5 Days

Rabbit polyclonal IL-33 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein.
IL33 Rabbit Polyclonal Antibody
TA319222

USD 530.00

5 Days

Rabbit polyclonal anti-IL-33 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein.
IL33 Rabbit Polyclonal Antibody
TA319223

USD 540.00

5 Days

Rabbit polyclonal IL-33 antibody Biotin Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein.
IL33 Mouse Monoclonal Antibody [Clone ID: 6H496]
TA337187

USD 430.00

5 Days

Mouse Monoclonal IL-33 Antibody (6H496)

Applications WB
Reactivities Human
Conjugation Unconjugated
IL33 Rabbit Polyclonal Antibody
TA359657

USD 360.00

5 Days

IL33 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL33
IL33 Rabbit Polyclonal Antibody
TA363665

USD 360.00

5 Days

IL33 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IL33
IL33 Rabbit Polyclonal Antibody
TA377468

USD 220.00

3 Weeks

IL33 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 95-270 of human IL33 (NP_254274.1).
Modifications Unmodified