Antibodies

Jump to Filters
View as table Download
Nucleotide binding protein like (NUBPL) Rabbit Polyclonal Antibody
TA331719

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUBPL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NUBPL Antibody is: synthetic peptide directed towards the C-terminal region of Human NUBPL. Synthetic peptide located within the following region: AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR
Nucleotide binding protein like (NUBPL) Rabbit Polyclonal Antibody
TA331720

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUBPL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NUBPL Antibody is: synthetic peptide directed towards the N-terminal region of Human NUBPL. Synthetic peptide located within the following region: MGIWQRLLLFGGVSLRAGGGATAPLGGSRAMVCGRQLSGAGSETLKQRRT
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI1C5]
CF503726

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5F8]
CF503729

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI5F8 (formerly 5F8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5D5]
CF503744

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI3D11]
CF503745

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI1C5]
TA503726

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI1C5]
TA503726S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5D5]
TA503744

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5D5]
TA503744S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI3D11]
TA503745

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI3D11]
TA503745S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated