Antibodies

Jump to Filters
View as table Download
AKR1C1 (1-323) Mouse Monoclonal Antibody [Clone ID: AT6D10]
AM09389PU-N

USD 340.00

2 Weeks

AKR1C1 (1-323) mouse monoclonal antibody, clone AT6D10, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
AKR1C1 (1-323) Mouse Monoclonal Antibody [Clone ID: AT6D10]
AM09389PU-S

USD 230.00

2 Weeks

AKR1C1 (1-323) mouse monoclonal antibody, clone AT6D10, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
AKR1C1 Rabbit Polyclonal Antibody
TA308032

USD 415.00

5 Days

Rabbit Polyclonal antibody to AKR1C1 (aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 22 and 248 of AKR1C1 (Uniprot ID#Q04828)
AKR1C1 Rabbit Polyclonal Antibody
TA342866

USD 375.00

5 Days

Rabbit Polyclonal Anti-AKR1C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: LERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATW
AKR1C1 Rabbit Polyclonal Antibody
TA342867

USD 375.00

5 Days

Rabbit Polyclonal Anti-AKR1C1 Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
AKR1C1 Rabbit Polyclonal Antibody
TA323179

USD 345.00

In Stock

Anti-AKR1C1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-304 amino acids of human aldo-keto reductase family 1, member C1