Rabbit Polyclonal Anti-CRH Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CRH antibody was raised against a 16 amino acid peptide near the amino terminus of human CRH. |
Rabbit Polyclonal Anti-CRH Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CRH antibody was raised against a 16 amino acid peptide near the amino terminus of human CRH. |
Rabbit Polyclonal Anti-CRH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRH antibody is: synthetic peptide directed towards the C-terminal region of Human CRH. Synthetic peptide located within the following region: GGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM |
USD 450.00
2 Weeks
Corticotropin Releasing Factor (CRH) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Rabbit Polyclonal Anti-CRH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRH |