Rabbit Polyclonal RIPK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIPK1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human RIPK1. |
Rabbit Polyclonal RIPK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIPK1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human RIPK1. |
RIP (RIPK1) (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal Anti-RIPK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RIPK1 antibody: synthetic peptide directed towards the middle region of human RIPK1. Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ |
Carrier-free (BSA/glycerol-free) RIPK1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIPK1 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIPK1 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIPK1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIPK1 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIPK1 mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2F1, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2F1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2F4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2F4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2D6, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2D6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2G3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2G3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | HRP |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 1A7, Biotinylated
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 1A7, HRP conjugated
Applications | WB |
Reactivities | Human, Dog |
Conjugation | HRP |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2A8, Biotinylated
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
RIPK1 mouse monoclonal antibody,clone 2A8, HRP conjugated
Applications | WB |
Reactivities | Human, Dog |
Conjugation | HRP |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |