Antibodies

View as table Download

Rabbit anti-LIPC Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LIPC

Rabbit Polyclonal Anti-LIPF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF. Synthetic peptide located within the following region: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH

Rabbit polyclonal antibody to Pancreatic Lipase (pancreatic lipase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 300 of Pancreatic Lipase (Uniprot ID#P16233)

Rabbit Polyclonal Anti-PNLIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ

Rabbit Polyclonal Antibody against Endothelial Lipase

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A C-terminal synthetic peptide made to the human endothelial lipase protein sequence.

Rabbit Polyclonal Antibody against Endothelial Lipase

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen An N-terminal synthetic peptide made to the human endothelial lipase protein sequence.

Rabbit Polyclonal Anti-PNLIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV

Goat Anti-Endothelial lipase Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RFNLRTSKDPEHEG, from the internal region of the protein sequence according to NP_006024.1.

Anti-LIPC Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 220 amino acids of human lipase, hepatic

Rabbit Polyclonal Anti-LIPC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPC antibody is: synthetic peptide directed towards the C-terminal region of LIPC. Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI9F2 (formerly 9F2)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI8E4 (formerly 8E4)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI7D1 (formerly 7D1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6B11 (formerly 6B11)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-PNLIP Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PNLIP

LIPC Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

LIPG mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

LIPG mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

LIPG mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

LIPG mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

LIPG mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

LIPG mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), Biotinylated

Applications IHC, IP, WB
Reactivities Human
Conjugation Biotin

LIPG mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated

Applications IHC, IP, WB
Reactivities Human
Conjugation HRP