Antibodies

View as table Download

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.

Rabbit anti-CCL5 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CCL5

Anti-Human RANTES Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RANTES (CCL5)

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN

Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)

Applications WB
Reactivities Human
Conjugation Unconjugated