Rabbit anti-POLR2D Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2D |
Rabbit anti-POLR2D Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2D |
Rabbit anti-POLR2J Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2J |
Rabbit anti-POLR2E Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2E |
Rabbit Polyclonal Anti-POLR1E Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR1E antibody: synthetic peptide directed towards the N terminal of human POLR1E. Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL |
Rabbit Polyclonal Anti-POLR3F Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the middle region of human POLR3F. Synthetic peptide located within the following region: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE |
Rabbit Polyclonal Anti-POLR1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR1B antibody: synthetic peptide directed towards the middle region of human POLR1B. Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD |
Rabbit anti-POLR2C Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human POLR2C |
POLR2I Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2I |
Rabbit Polyclonal Anti-POLR2C Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Polr2c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Polr2c. Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR |
Rabbit Polyclonal Anti-POLR3H Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL |
Rabbit Polyclonal Anti-POLR2K Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2K antibody: synthetic peptide directed towards the middle region of human POLR2K. Synthetic peptide located within the following region: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR |
Rabbit Polyclonal Anti-POLR2H Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2H antibody: synthetic peptide directed towards the N terminal of human POLR2H. Synthetic peptide located within the following region: DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE |
Rabbit Polyclonal Anti-POLR3F Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the N terminal of human POLR3F. Synthetic peptide located within the following region: MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR |
Rabbit Polyclonal Anti-POLR3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3A antibody: synthetic peptide directed towards the middle region of human POLR3A. Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT |
Rabbit Polyclonal Anti-POLR1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF |
Rabbit Polyclonal Anti-POLR3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3B antibody: synthetic peptide directed towards the C terminal of human POLR3B. Synthetic peptide located within the following region: IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED |
Rabbit Polyclonal Anti-NM23 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NM23 Antibody: A synthesized peptide derived from human NM23 |
Rabbit Polyclonal POLR3F Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | POLR3F antibody was raised against a 21 amino acid peptide from near the amino terminus of human POLR3F. |
Rabbit polyclonal antibody to POLR3A (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 182 and 482 of POLR3A (Uniprot ID#O14802) |
Rabbit Polyclonal antibody to POLR2B (polymerase (RNA) II (DNA directed) polypeptide B, 140kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 172 of RNA polymerase IIB (Uniprot ID#P30876) |
Rabbit polyclonal anti-NM23 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human NM23. |
Rabbit polyclonal anti-RPC4 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC4. |
Rabbit polyclonal anti-POLR3H (RPC8) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC8. |
Rabbit polyclonal NME2 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This NME2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 25-54 amino acids from the N-terminal region of human NME2. |
Rabbit polyclonal RPC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC3. |
Rabbit polyclonal antibody to POLR2G (polymerase (RNA) II (DNA directed) polypeptide G)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 122 of RNA polymerase IIG (Uniprot ID#P62487) |
Rabbit polyclonal anti-RPC2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC2. |
Rabbit polyclonal anti-POLR1B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human POLR1B. |
Anti-POLR1C Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 200 amino acids of human polymerase (RNA) I polypeptide C, 30kDa |
Goat Anti-POLR2G Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EFDPNSNPPCYK, from the internal region of the protein sequence according to NP_002687.1. |
Rabbit polyclonal antibody to RPB8 (polymerase (RNA) II (DNA directed) polypeptide H)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of RPB8 (Uniprot ID#P52434) |
Rabbit polyclonal anti-RPAB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced againstsynthesized peptide derived from internal of human RPAB1. |
Rabbit polyclonal anti-RPC1 / POLR3A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC1. |
Anti-POLR2I Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-POLR2D Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-POLR1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-POLR1C antibody is: synthetic peptide directed towards the N-terminal region of Human POLR1C. Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA |
Rabbit Polyclonal Anti-POLR2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2B antibody: synthetic peptide directed towards the middle region of human POLR2B. Synthetic peptide located within the following region: FFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLI |
Rabbit Polyclonal Anti-POLR2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2B antibody: synthetic peptide directed towards the N terminal of human POLR2B. Synthetic peptide located within the following region: TYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTD |
Rabbit Polyclonal Anti-POLR2I Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: ACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQ |
Rabbit Polyclonal Anti-POLR3C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3C antibody: synthetic peptide directed towards the middle region of human POLR3C. Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV |
Rabbit Polyclonal Anti-POLR2I Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS |
Rabbit Polyclonal Anti-NME2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NME2 |
Rabbit polyclonal anti-POLR2G Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2G |
Rabbit polyclonal anti-POLR2G Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2G |