USD 340.00
2 Weeks
Growth Arrest Specific Protein 7 (GAS7) mouse monoclonal antibody, clone AT4H8, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
USD 340.00
2 Weeks
Growth Arrest Specific Protein 7 (GAS7) mouse monoclonal antibody, clone AT4H8, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
USD 230.00
2 Weeks
Growth Arrest Specific Protein 7 (GAS7) mouse monoclonal antibody, clone AT4H8, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal anti-GAS7 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK |
USD 450.00
2 Weeks
Growth Arrest Specific Protein 7 (GAS7) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human GAS7 |
Rabbit Polyclonal Anti-GAS7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGW |
Rabbit Polyclonal Anti-GAS7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the C terminal of human GAS7. Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI9H6 (formerly 9H6)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-GAS7 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 184-382 amino acids of human growth arrest-specific 7 |
USD 379.00
In Stock
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | HRP |
USD 159.00
In Stock
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |