Antibodies

Jump to Filters
View as table Download
METTL7A Rabbit Polyclonal Antibody
TA346478

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-METTL7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL7A antibody: synthetic peptide directed towards the N terminal of human METTL7A. Synthetic peptide located within the following region: MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN
METTL7A Rabbit Polyclonal Antibody
TA306679

USD 430.00

5 Days

Rabbit Polyclonal MettL7A Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MettL7A antibody was raised against a 13 amino acid peptide near the center of human MettL7A.
METTL7A Rabbit Polyclonal Antibody
AP23001PU-N

USD 440.00

2 Weeks

METTL7A rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen METTL7A antibody was raised against mettL7A antibody was raised against a 13 amino acid peptide near the center of Human MettL7A.
METTL7A Rabbit Polyclonal Antibody
TA306674

USD 430.00

5 Days

Rabbit Polyclonal MettL7A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MettL7A antibody was raised against a 12 amino acid peptide near the carboxy terminus of human MettL7A.
METTL7A Mouse Monoclonal Antibody [Clone ID: OTI4B10]
CF809878

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) METTL7A mouse monoclonal antibody,clone OTI4B10

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
METTL7A Mouse Monoclonal Antibody [Clone ID: OTI4B10]
TA809878

USD 379.00

In Stock

METTL7A mouse monoclonal antibody,clone OTI4B10

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
METTL7A Mouse Monoclonal Antibody [Clone ID: OTI4B10]
TA809878S

USD 159.00

In Stock

METTL7A mouse monoclonal antibody,clone OTI4B10

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated