Mouse Monoclonal Antibody against TRA-1-81 (TRA-1-81) - Embryonic Stem Cell Marker
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against TRA-1-81 (TRA-1-81) - Embryonic Stem Cell Marker
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against TRA-1-60 (TRA-1-60(R)) -Neuraminidase resistant -Embryonic Stem Cell Marker
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Podocalyxin Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide within an internal region (residues 100-200) of the human Podocalyxin protein. [Swiss-Prot# O00592] This immunogen should be far enough away from any glycosylation site. |
Rabbit Polyclonal Anti-PODXL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PODXL Antibody: synthetic peptide directed towards the middle region of human PODXL. Synthetic peptide located within the following region: PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ |
Goat Polyclonal Antibody against PODXL
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DNLTKDDLDEEEDTH, from the C Terminus of the protein sequence according to NP_001018121.1 ; NP_005388.2. |
Rabbit Polyclonal Anti-PODXL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PODXL Antibody: synthetic peptide directed towards the N terminal of human PODXL. Synthetic peptide located within the following region: TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT |
Carrier-free (BSA/glycerol-free) PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
PODXL mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |