CSNK2A2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSNK2A2 |
CSNK2A2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSNK2A2 |
Rabbit anti-CSNK2A2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CSNK2A2 |
Rabbit Polyclonal Anti-CSNK2A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD |
Rabbit Polyclonal Anti-CSNK2A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
CSNK2A2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSNK2A2 |
CSNK2A2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human CSNK2A2 (NP_001887.1). |
Modifications | Unmodified |