Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
EGF rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EGF |
Pro-EGF Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (near the N terminus) (SRQERVCNIEKNVS) |
Carrier-free (BSA/glycerol-free) EGF mouse monoclonal antibody,clone OTI8E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-250 of human EGF (NP_001954.2). |
| Modifications | Unmodified |
EGF Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 850-950 of human EGF (NP_001954.2). |
| Modifications | Unmodified |
EGF mouse monoclonal antibody,clone OTI2F9
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGF mouse monoclonal antibody,clone OTI8E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGF mouse monoclonal antibody,clone OTI8E2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
EGF mouse monoclonal antibody,clone OTI8E2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
EGF mouse monoclonal antibody,clone OTI8E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- EGF
Reactivities
- Human
Applications
- WB
Filter by
Category
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
Pathways
- Bladder cancer (16)
- Cytokine-cytokine receptor interaction (16)
- Endocytosis (16)
- Endometrial cancer (16)
- ErbB signaling pathway (16)
- Focal adhesion (16)
- Gap junction (16)
- Glioma (16)
- MAPK signaling pathway (16)
- Melanoma (16)
- Non-small cell lung cancer (16)
- Pancreatic cancer (16)
- Pathways in cancer (16)
- Prostate cancer (16)
- Regulation of actin cytoskeleton (16)