Antibodies

View as table Download

Rabbit Polyclonal Anti-METTL7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL7A antibody: synthetic peptide directed towards the N terminal of human METTL7A. Synthetic peptide located within the following region: MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN

Rabbit Polyclonal MettL7A Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MettL7A antibody was raised against a 13 amino acid peptide near the center of human MettL7A.

Rabbit Polyclonal MettL7A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MettL7A antibody was raised against a 12 amino acid peptide near the carboxy terminus of human MettL7A.

Carrier-free (BSA/glycerol-free) METTL7A mouse monoclonal antibody,clone OTI4B10

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

METTL7A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human METTL7A

METTL7A Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-244 of human METTL7A (NP_054752.3).
Modifications Unmodified

METTL7A mouse monoclonal antibody,clone OTI4B10

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

METTL7A mouse monoclonal antibody,clone OTI4B10

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated