Antibodies

Jump to Filters
View as table Download
Corticotropin Releasing Factor (CRH) Rabbit Polyclonal Antibody
TA349055

USD 484.00

5 Days

Rabbit Polyclonal Anti-CRH Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CRH antibody was raised against a 16 amino acid peptide near the amino terminus of human CRH.
Corticotropin Releasing Factor (CRH) Rabbit Polyclonal Antibody
TA346216

USD 475.00

5 Days

Rabbit Polyclonal Anti-CRH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRH antibody is: synthetic peptide directed towards the C-terminal region of Human CRH. Synthetic peptide located within the following region: GGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM
Corticotropin Releasing Factor (CRH) Rabbit Polyclonal Antibody
TA350642

USD 345.00

In Stock

Rabbit Polyclonal Anti-CRH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRH
Corticotropin Releasing Factor (CRH) Rabbit Polyclonal Antibody
TA375087

USD 220.00

3 Weeks

CRH Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human CRH (NP_000747.1).
Modifications Unmodified