Rabbit Polyclonal Anti-RBM35B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of human RBM35B. Synthetic peptide located within the following region: ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ |
Rabbit Polyclonal Anti-Esrp2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Esrp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT |
Mouse monoclonal Esrp-2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Mouse monoclonal Esrp-1/2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-RBM35B antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of mouse RBM35B. Synthetic peptide located within the following region: EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF |
Esrp2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Esrp2 |
ESRP2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ESRP2 |
Germany
Japan
United Kingdom
China
