Antibodies

Jump to Filters
View as table Download
TLR9 Rabbit Polyclonal Antibody
TA306291

USD 430.00

2 Weeks

Rabbit Polyclonal TLR9 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLR9 antibody was raised against a peptide corresponding to 15 amino acids near the center of human TLR9.
TLR9 Mouse Monoclonal Antibody [Clone ID: 26C593.2]
TA337047

USD 512.00

Backordered

Mouse Monoclonal TLR9 Antibody (26C593.2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated
TLR9 Rabbit Polyclonal Antibody
TA306290

USD 430.00

3 Weeks

Rabbit Polyclonal TLR9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR9 antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human TLR9.
TLR9 (N-term) Goat Polyclonal Antibody
AP31274PU-N

USD 440.00

2 Weeks

TLR9 (N-term) goat polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Hamster, Mouse
Immunogen Synthetic peptide LSLKYNNLTKVPRQLPPSLEY-C corresponding to amino acids 204-224 of the N-terminal domain of mouse TLR9
TLR9 (26-300) Rabbit Polyclonal Antibody
AP31723PU-N

USD 440.00

2 Weeks

TLR9 (26-300) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 26 and 300 of Human CD289(TLR9)
TLR9 (1050-1100) Rabbit Polyclonal Antibody
RA25070-100

USD 410.00

2 Weeks

TLR9 (1050-1100) rabbit polyclonal antibody

Applications WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
TLR9 Rabbit Polyclonal Antibody
TA331898

USD 375.00

5 Days

Rabbit Polyclonal Anti-TLR9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TLR9 Antibody: synthetic peptide directed towards the N terminal of human TLR9. Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
TLR9 Rabbit Polyclonal Antibody
TA382574

USD 220.00

3 Weeks

TLR9 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TLR9 (NP_059138.1).
Modifications Unmodified