Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-CD253 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
Antibodies
View as table Download
Rabbit Polyclonal Trail Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail. |
Tnfsf10 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2. |
Tnfsf10 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2. |
Rabbit anti CD253/TRAIL/ (TNFSF10) (IN1) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of TRAIL protein (from 115aa-140aa). This sequence is identical to human and mouse. |
Rabbit Polyclonal Anti-TNFSF10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10. Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE |
Rabbit anti CD253/TRAIL (IN2) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of human TRAIL protein (from 160aa-190aa). This sequence is has one amino acid difference from rat origin. |
Rabbit anti CD253/TRAIL (CT) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of TRAIL protein (from 230aa-280aa). This sequence is identical to human, rat and mouse. |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI12E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI2C12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFSF10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFSF10 (NP_003801.1). |
| Modifications | Unmodified |
TNFSF10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFSF10 (NP_003801.1). |
| Modifications | Unmodified |
TNFSF10 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 39-250 of human TNFSF10 (NP_003801.1). |
| Modifications | Unmodified |
TNFSF10 mouse monoclonal antibody,clone OTI12E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI12E12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI12E12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFSF10 mouse monoclonal antibody,clone OTI12E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TNFSF10 mouse monoclonal antibody,clone OTI2C12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI2C12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI2C12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFSF10 mouse monoclonal antibody,clone OTI2C12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TNFSF10 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI6B5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI6B5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFSF10 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI9A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TNFSF10
Applications
- WB