Rabbit Polyclonal KLOTHO Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KLOTHO antibody was raised against a 16 amino acid synthetic peptide near the center of human KLOTHO. |
Rabbit Polyclonal KLOTHO Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KLOTHO antibody was raised against a 16 amino acid synthetic peptide near the center of human KLOTHO. |
Rabbit Polyclonal Anti-KL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS |
Rabbit Polyclonal Anti-KL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: HRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLE |
Rabbit Polyclonal Anti-KL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KL |
Kl Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
KL Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KL (NP_004786.2). |
Modifications | Unmodified |
Klotho Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Produced from sera of rabbits pre-immunized with highly pure recombinant Human Klotho. Anti-Human Klotho specific antibody was purified by affinity chromatography employing immobilized Human Klotho matrix. |
Klotho Antibody (biotin)
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hKlotho. Anti-Human Klotho specific antibody was purified by affinity chromatography and then biotinylated. |