Antibodies

Jump to Filters
View as table Download
MAGE 1 (MAGEA1) Mouse Monoclonal Antibody [Clone ID: MA454]
AM32863PU-T

USD 240.00

2 Weeks

MAGE 1 (MAGEA1) mouse monoclonal antibody, clone MA454, Purified

Applications FC, IF, IHC, IP, WB
Reactivities Canine, Human, Rat
MAGE 1 (MAGEA1) Rabbit Polyclonal Antibody
TA347677

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MAGE-1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGE-1 Antibody: A synthesized peptide derived from human MAGE-1
MAGE 1 (MAGEA1) Rabbit Polyclonal Antibody
TA312178

USD 345.00

2 Weeks

Rabbit polyclonal anti-MAGE-1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MAGE-1.
MAGE 1 (MAGEA1) Rabbit Polyclonal Antibody
TA339275

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAGEA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGEA1 antibody: synthetic peptide directed towards the N terminal of human MAGEA1. Synthetic peptide located within the following region: LVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEG
MAGE 1 (MAGEA1) Rabbit Polyclonal Antibody
TA339276

USD 310.00

5 Days

Rabbit Polyclonal Anti-MAGEA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGEA1 antibody: synthetic peptide directed towards the C terminal of human MAGEA1. Synthetic peptide located within the following region: MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE
MAGE 1 (MAGEA1) Rabbit Polyclonal Antibody
TA378204

USD 220.00

3 Weeks

MAGE-1/MAGE1A Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human MAGE-1/MAGE1A (NP_004979.3).
Modifications Unmodified