Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 42 of 42 results

(reset)

Nucleotide binding protein like (NUBPL) Rabbit Polyclonal Antibody

TA331719

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUBPL Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-NUBPL Antibody is: synthetic peptide directed towards the C-terminal region of Human NUBPL. Synthetic peptide located within the following region: AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR

Nucleotide binding protein like (NUBPL) Rabbit Polyclonal Antibody

TA331720

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUBPL Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-NUBPL Antibody is: synthetic peptide directed towards the N-terminal region of Human NUBPL. Synthetic peptide located within the following region: MGIWQRLLLFGGVSLRAGGGATAPLGGSRAMVCGRQLSGAGSETLKQRRT

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI2C8]

CF503725

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI1C5]

CF503726

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5F8]

CF503729

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI5F8 (formerly 5F8)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI2G7]

CF503731

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5D5]

CF503744

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI3D11]

CF503745

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

CF503746

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5C12]

CF503748

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUBPL mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI2C8]

TA503725

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C8]

TA503725AM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C8]

TA503725BM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI2C8]

TA503725S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA503726

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C5]

TA503726AM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]

TA503726BM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA503726S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5F8]

TA503729

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI5F8 (formerly 5F8)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F8]

TA503729AM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI5F8 (formerly 5F8), Biotinylated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F8]

TA503729BM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI5F8 (formerly 5F8), HRP conjugated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5F8]

TA503729S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI5F8 (formerly 5F8)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI2G7]

TA503731

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G7]

TA503731AM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI2G7 (formerly 2G7), Biotinylated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G7]

TA503731BM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI2G7 (formerly 2G7), HRP conjugated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI2G7]

TA503731S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5D5]

TA503744

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]

TA503744AM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D5]

TA503744BM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5D5]

TA503744S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI3D11]

TA503745

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D11]

TA503745AM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D11]

TA503745BM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI3D11]

TA503745S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

TA503746

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D6]

TA503746AM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI7D6 (formerly 7D6), Biotinylated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D6]

TA503746BM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI7D6 (formerly 7D6), HRP conjugated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

TA503746S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5C12]

TA503748

USD 379.00

In Stock

NUBPL mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C12]

TA503748AM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI5C12 (formerly 5C12), Biotinylated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C12]

TA503748BM

USD 420.00

4 Weeks

NUBPL mouse monoclonal antibody, clone OTI5C12 (formerly 5C12), HRP conjugated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody [Clone ID: OTI5C12]

TA503748S

USD 159.00

2 Days

NUBPL mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

1 - 42 of 42 results