Antibodies

View as table Download

Goat Polyclonal Antibody against Silver homologue / Pmel 17

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CPIGENSPLLSGQQ, from the C Terminus of the protein sequence according to NP_008859.1.

Rabbit Polyclonal Anti-SILV Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SILV antibody: synthetic peptide directed towards the N terminal of human SILV. Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications IF, IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

PMEL Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-300 of human PMEL (NP_008859.1).
Modifications Unmodified

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications IF, IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Dog
Conjugation Biotin

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Dog
Conjugation HRP

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications IF, IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Biotin

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation HRP

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Biotin

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation HRP

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)

Applications WB
Reactivities Human
Conjugation Unconjugated

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)

Applications WB
Reactivities Human
Conjugation Unconjugated

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human
Conjugation Unconjugated